PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009764998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 589aa    MW: 64999.6 Da    PI: 7.0382
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009764998.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.5e-11411469563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l  l+  ++ l+s++
  XP_009764998.1 411 KRAKRILANRQSAARSKERKMRYIAELEHKVQTLQTEATTLSAQLTLLQRDSSGLTSQN 469
                     9*************************************************999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-18407471IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875409472IPR004827Basic-leucine zipper domain
PfamPF001706.9E-10411469IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11411461No hitNo description
Gene3DG3DSA:1.20.5.1705.7E-11411468No hitNo description
CDDcd147031.31E-23412461No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 589 aa     Download sequence    Send to blast
MGGESDEANT EMMRRLQSSF GTSSSSLQKP QYISTNQLDI PQLSTSQFHG QMRQFSPNFG  60
VENSTKRVGV SPSHPQMPPI SPYSHIPVGR PTSQQHGMQS FTTQGPSHSR SLSQPSFFSL  120
DSLPPLSPSP YKESLSTFIS DPVAADVSME DRDGNSHSSL PPSPFSRCNS SRVGESLPPR  180
KAHRRSNSDI PFGFSSIMQS SPPLVPSRSP AQLVKREAYW DKSNDKNAEG MGERKSEGEV  240
VDDLFSAYMN LDNIESLNSS GVDEKQGNEN REDLDSRASG TKTNGCDSSD NEATSSVNDS  300
GSSMHTLGMS SSTEKREGIK RSAEGDIAPT VRHYRSVSMD SFMGKLNFGD ESPKLPPSPG  360
PHHGQLSPTN SLDANSESFS LEFGNGEFNG AELKKIMANE KLAEIALADP KRAKRILANR  420
QSAARSKERK MRYIAELEHK VQTLQTEATT LSAQLTLLQR DSSGLTSQNN ELKFRLQAME  480
QQAHLRDALN EALTAEVQRL KIATAELNGD AAKFQQLSLN PQMFQLQRQM ATQLSMHQLQ  540
HQQQQQQQQQ QQQQQQQQEK ASSQHQQHAQ AKQQQQQQNS SAPAMHGSK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764999.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_009764998.10.0PREDICTED: probable transcription factor PosF21
TrEMBLA0A0V0IRP90.0A0A0V0IRP9_SOLCH; Putative transcription factor RF2a-like
STRINGPGSC0003DMT4000041780.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-151bZIP family protein